{"title":"Fantasy \u0026 Paranormal","description":"","products":[{"product_id":"tails-of-fate-a-m-nelson","title":"Tails of Fate - A M Nelson","description":"\u003cp\u003eMermaids aren’t real… they’re the stuff of fairytales, right?\u003c\/p\u003e\n\u003cp\u003eTeagan assumes she’s a regular human, and there is nothing special or unique about herself. She prefers to read about adventure instead of partaking in it.\u003c\/p\u003e\n\u003cp\u003eSurrounding a twenty-year-old prophecy, Benji will shatter that illusion and force Teagan into unfamiliar waters - which fills her with dread, confusion, and a sense of purpose.\u003c\/p\u003e\n\u003cp\u003eFighting against forces who want all the power for themselves, Limulora relies on the prophecy coming to fruition to continue thriving as an underwater city. Lives are at stake, and Teagan is at the centre of it all.\u003c\/p\u003e\n\u003cp\u003eAdventure, love, death, and a found family await Teagan as she unwillingly joins Benji on a journey that will reshape the way she thinks about the world, and most importantly, herself.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eThis book contains mature scenes that are intended for an audience of 18+\u003c\/p\u003e","brand":"A M Nelson","offers":[{"title":"Signed","offer_id":42509963755610,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/tailsoffateamnelson.jpg?v=1762151144"},{"product_id":"project-eden-ec-cardie","title":"Project Eden - E C Cardey","description":"\u003cp\u003eIt begins with the end of the world.\u003c\/p\u003e\n\u003cp\u003eFire and floods consume everything, leaving behind a desolate wasteland uninhabitable for humans.\u003c\/p\u003e\n\u003cp\u003eYears later, two strangers awake from stasis, the names ADAM and EVE tattooed on their arms.\u003c\/p\u003e\n\u003cp\u003eTogether they are forced to navigate a world completely different from the one they left behind, while haunted by the memories of their pasts.\u003c\/p\u003e\n\u003cp\u003eCan they find a way to survive this unfamiliar land together? And are they truly alone out there?\u003c\/p\u003e","brand":"E C Cardey","offers":[{"title":"Default Title","offer_id":42518426976346,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/projectedeneccardey.jpg?v=1762293732"},{"product_id":"demon-desired-ysadora-sonderling","title":"Demon Desired - Ysadora Sonderling","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"10vn5t-wmj847-oy9pow-cgpx45\" data-cel-widget=\"productTitle\"\u003eThe Bayton Agency Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003eNewly graduated law enforcement Agent, Tessa Bale is a witch. Upon surviving her low-paying internship and a sleazy boss, she is handed the most gruesome magickal murder case that could be found.\u003c\/p\u003e\n\u003cp\u003eSucceeding won't be easy, pitting Tessa against the most vicious creatures magick can create while traversing the slums of Bayton. To survive, she will be forced to make an alliance with a mysterious demon.\u003c\/p\u003e\n\u003cp\u003eEverything about Lee is forbidden. He's an efficient killer, addictively alluring, and holds powerful magick. Yet, what terrifies Tessa most is not the blood connection they now share, but that she finds herself oddly drawn to him.\u003c\/p\u003e\n\u003cp\u003eBut with a serial murderer on the loose, literal zombies walking the streets, and a brutal gang ex-lover on the rampage, Tessa must use every trick in her arsenal if she hopes to see the dawn.\u003c\/p\u003e","brand":"Ysadora Sonderling","offers":[{"title":"Signed","offer_id":42518450765914,"sku":null,"price":28.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/demondesiredysadorasondering.jpg?v=1762294927"},{"product_id":"demon-hunted-ysadora-sonderling","title":"Demon Hunted - Ysadora Sonderling","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"10vn5t-wmj847-oy9pow-cgpx45\" data-cel-widget=\"productTitle\"\u003eThe Bayton Agency Book #2\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003eRejoin the world of Tessa and Lee as they attempt to hide their forbidden love, and a 6ft tall demon with horns poking out of his head. After breaking the law, Tessa must now lie to those around her to save her job and her life. She must balance her law enforcement job, seeking a man who is killing local Bayton women in their own homes and a terrifying demon with obsidian horns that is now stalking her.\u003c\/p\u003e","brand":"Ysadora Sonderling","offers":[{"title":"Signed","offer_id":42518454501466,"sku":null,"price":28.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/demonhuntedysadorasondering.jpg?v=1762295012"},{"product_id":"power-wealth-courage-susan-hoddy","title":"Power Wealth \u0026 Courage - Susan Hoddy","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"qbd5pv-aq5q1o-ou9vh3-gpe3wr\" data-cel-widget=\"productTitle\"\u003eEmpire Of The Legacies Academy Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eIn a world of ancient legacies, forbidden love, and treacherous betrayal, one academy stands between order and chaos.\u003c\/p\u003e\n\u003cp\u003eHawk, the rebellious heir to the Griffins of Olden Fjord, and Sully, a fiercely independent Lepidoptera Vampire warrior, are forced to confront their fates when they meet at the Empire of the Legacies Academy. Though their paths collide with sparks of animosity, a deeper connection begins to form—one that might be the only hope against an imminent darkness.\u003c\/p\u003e\n\u003cp\u003eEryndor, Hawk’s adopted brother, harbors a secret that could shatter their world. Driven by jealousy and an insatiable thirst for power, he steals the legendary Twin Icefire Blades—ancient artifacts of fire and ice said to hold the power to reshape reality. With these sacred weapons, Eryndor sets his sights on revenge, vowing to bring down Norway, and plunge the world into chaos.\u003c\/p\u003e\n\u003cp\u003eAs Hawk and Sully navigate the academy’s trials, their bond is tested by betrayal, destiny, and the weight of an ancient prophecy. Can they help to stop Eryndor before the blades unleash their destructive potential? Or will their love—and the world—burn in the fires of ambition?\u003c\/p\u003e\n\u003cp\u003eEpic battles, forbidden romance, and a fight for the fate of humanity await in this thrilling tale of love, loyalty, and legacy.\u003c\/p\u003e","brand":"Susan Hoddy","offers":[{"title":"Signed","offer_id":42518459449434,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_46.png?v=1779343707"},{"product_id":"betrayed-by-blood-ivy-thorp","title":"Betrayed By Blood - Ivy Thorp","description":"\u003ch3\u003e\u003cem\u003e\u003cstrong\u003eBound by Crimson Ties Book #1\u003c\/strong\u003e\u003c\/em\u003e\u003c\/h3\u003e\n\u003cp\u003eVictoria Sterling's charmed life is shattered when a chilling secret lurks within her family's legacy. After discovering a blood-stained note revealing her father’s hidden debts, she realizes the stakes have never been higher.\u003cbr\u003eWith her brother's life at risk, she plunges into a dark world of vampires and warlocks. Betrayed by her lineage, Victoria must confront the chilling shadows that threaten her family. Can she unravel the secrets before it’s too late?\u003cbr\u003eThe choice is clear: save her brother or face the terrifying truth alone.\u003c\/p\u003e","brand":"Ivy Thorp","offers":[{"title":"Signed","offer_id":42518479634522,"sku":null,"price":30.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/betrayedbybloodivythorp.jpg?v=1762295433"},{"product_id":"a-kingdom-of-curses-danielle-d-drummond","title":"A Kingdom Of Curses - Danielle D Drummond","description":"\u003ch3\u003eOriginal Sin Book #1\u003c\/h3\u003e\n\u003cp\u003eOne forgotten sin. A thousand deadly consequences.\u003c\/p\u003e\n\u003cp\u003ePaege Vailenbyrg has always been an outsider in the Wolf-ruled kingdom of Elyndria. As a half-Fae, half-Human hybrid, she’s considered an aberration. Despite her efforts to discover her place in a world made to reject her, Paege finds herself unexpectedly embroiled in a web of secrets, lies, and unreliable magic. All of it threatens to shatter the fragile sense of safety she has managed to build around herself.\u003c\/p\u003e\n\u003cp\u003eCaught between two worlds, Paege must navigate shifting alliances and uncover long-buried secrets. The fate of the kingdom hangs in the balance as she becomes a pawn in a much larger game. Can she trust the enigmatic Wolf shifter, Guy Braxtion, whose dark past is as tangled as her own? Or the notorious bad boy heir, Quentin Ishaan, whose sudden interest in her raises more questions than answers?\u003c\/p\u003e","brand":"Danielle D Drummond","offers":[{"title":"Trade Edition","offer_id":42519606952026,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true},{"title":"Special Edition","offer_id":42519606984794,"sku":null,"price":75.0,"currency_code":"AUD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/akingdomofcurses.jpg?v=1762308554"},{"product_id":"to-kill-a-nightmare-natasha-madden","title":"To Kill A Nightmare - Natasha Madden","description":"\u003cp\u003eAmelia Shadowmire has always known her magic was different—darker, wilder, and dangerously hard to control.\u003c\/p\u003e\n\u003cp\u003eWhen an incident at home pushes things too far, her father sends her across the world to live with an aunt she barely knows, in a remote German village steeped in ancient secrets and shadowed forests. There, Amelia must confront the part of herself she fears most—and the legacy that runs in her blood.\u003cbr\u003eAs Amelia struggles to master her gifts, something evil is stirring in the woods, watching, waiting, calling to her magic.\u003cbr\u003eCan she learn to control the darkness within before it consumes her?\u003c\/p\u003e","brand":"Natasha Madden","offers":[{"title":"Signed","offer_id":42519620812890,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/tokillanightmarenatashamadden.jpg?v=1762309650"},{"product_id":"lores-of-fate-kasey-cumming","title":"Lores Of Fate - Kasey Cumming","description":"\u003ch3\u003e\n\u003cstrong\u003eSeer's End Book 1\u003c\/strong\u003e\u003cbr\u003e\n\u003c\/h3\u003e\n\u003cp\u003eIn the very beginning of the world where shifters, witches and dark creatures alike were yet to walk the earthly planes, the gods of six fates made a home for themselves in the world of Luminara. Carving territories with their favourite creations. Once bored of this star, they left behind little pieces of themselves in the bodies of six creations to guide and watch over their territories, hiding gifts beneath their skins. Yet, in their boredom, they seem to be playing a game of fated chess against each other; their pieces are those creatures that walk alongside the humans they created.\u003c\/p\u003e\n\u003cp\u003eLORELAI\u003c\/p\u003e\n\u003cp\u003eMy mind has always struggled with the web of questions it holds in.\u003c\/p\u003e\n\u003cp\u003eI refuse to believe the world has forgotten the time before the reign of the power-thirsty king. I tire of the bleeding future held for women in Asterous. Our freedom came at a cost, to forget the old ways and embrace the god of mankind.\u003c\/p\u003e\n\u003cp\u003eMy path out of here won’t be easy, the beatings I’ve received tell me as much.\u003c\/p\u003e\n\u003cp\u003eA change of fate holds the secrets to my heritage, shattering my heart in the process.\u003c\/p\u003e\n\u003cp\u003eI’m caught in the middle of a war I didn’t start. I can’t trust him; his eyes hold too much pain.\u003c\/p\u003e\n\u003cp\u003eIt’s the eyes that always get me.\u003c\/p\u003e\n\u003cp\u003eJASPER\u003c\/p\u003e\n\u003cp\u003eMagick hums through my veins, the beast rattles violently at the bones in my chest at the mere sight of her.\u003c\/p\u003e\n\u003cp\u003eShe’s mine for the taking, not his.\u003c\/p\u003e\n\u003cp\u003eThe mind has always been a fragile thing, easily warped and destroyed…if I chose it.\u003c\/p\u003e\n\u003cp\u003eThe threads of fate cannot be denied, it's our lore. The balance must be kept.\u003c\/p\u003e\n\u003cp\u003eWhether her mind can withstand its unravelling remains to be seen, and I’ll take pleasure in knowing I was a part of her undoing.\u003c\/p\u003e\n\u003cp\u003ethe feral side of me that thirsts for her fear, her pain.\u003c\/p\u003e\n\u003cp\u003eI’m coming for you Ory.\u003c\/p\u003e\n\u003cp\u003eIt's time you came home.\u003c\/p\u003e","brand":"Kasey Cumming","offers":[{"title":"Signed Book 1","offer_id":42519637426266,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":false},{"title":"Signed Series Bundle Books 1-3","offer_id":43413348122714,"sku":null,"price":85.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/loresoffateskaseycumming.jpg?v=1762309854"},{"product_id":"the-secrets-of-demons-e-c-glynn","title":"Heretic Behaviour: The Secrets of Demons","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"g87c1e-db5e63-997r4i-amq8eo\" data-cel-widget=\"productTitle\"\u003eHeretic Behaviour Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eThe elite are always heretics when it suits them.\u003c\/p\u003e\n\u003cp\u003eMila’s time is up. After years spent hiding, she’s been caught by the Church, accused of being a demon, and offered as sacrifice to the all-powerful God-King Midas. However, her fate takes an unexpected turn when the cruel and beautiful Princess Jezebel stays Mila’s execution on the condition that Mila entertains her at court with her unusual power.\u003c\/p\u003e\n\u003cp\u003eThe arrival of a handsome, enigmatic, and ruthless merchant prince throws Mila’s efforts to escape into turmoil. Will his arrival be her undoing…or her path to freedom?\u003c\/p\u003e\n\u003cp\u003eA twist on an old myth, and brimming with court intrigue, adventure, and forbidden romance, Heretic Behaviour will leave readers breathless and begging for more.\u003c\/p\u003e","brand":"E C Glynn","offers":[{"title":"Signed","offer_id":42519639621722,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/thesecretsofdemonsecgylnn.jpg?v=1762310625"},{"product_id":"the-lies-of-madas-e-c-glynn","title":"Heretic Behaviour: The Lies of Midas - E C Glynn","description":"\u003cp\u003eThe elite are always heretics when it suits them.\u003c\/p\u003e\n\u003cp\u003eMila’s time is up. After years spent hiding, she’s been caught by the Church, accused of being a demon, and offered as sacrifice to the all-powerful God-King Midas. However, her fate takes an unexpected turn when the cruel and beautiful Princess Jezebel stays Mila’s execution on the condition that Mila entertains her at court with her unusual power.\u003c\/p\u003e\n\u003cp\u003eThe arrival of a handsome, enigmatic, and ruthless merchant prince throws Mila’s efforts to escape into turmoil. Will his arrival be her undoing…or her path to freedom?\u003c\/p\u003e\n\u003cp\u003eA twist on an old myth, and brimming with court intrigue, adventure, and forbidden romance, Heretic Behaviour will leave readers breathless and begging for more.\u003c\/p\u003e","brand":"E C Glynn","offers":[{"title":"Signed","offer_id":42519688511578,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/91GgOL_qDrL._SL1500.jpg?v=1779177501"},{"product_id":"still-waters-run-deep-mg-hunt","title":"Still Waters Run Deep - MG Hunt","description":"\u003ch3\u003e\u003cstrong\u003eBook #1 \u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eIn a world where elemental magik is forbidden, Asta has a secret.\u003cbr\u003eLiving in the peaceful village of Laugar, she keeps her water affinity hidden from everyone. Including the people closest to her. Asta’s life changes forever when she is forced to leave her home and is kidnapped by a hidden group of elemental affinities, known as Velum.\u003c\/p\u003e\n\u003cp\u003eIn Velum, Asta encounters other young people like herself. Rather than hiding their elemental powers, they embrace them. For better or worse.\u003c\/p\u003e\n\u003cp\u003eAsta soon learns that things at Velum aren’t as they seem. She has to endure the domineering ways of Gatira, Velum’s creator. Gatira is a curious, undead scholar, who seeks not only to enhance the elemental powers of the affinities she looks after, but to serve her own controlling self interests. And she is a force Asta must choose to serve under, or to reckon with.\u003c\/p\u003e\n\u003cp\u003eDive into a world of elemental magik, secrets, evolving friendships, and blossoming romances. ‘Still Waters Run Deep’ is the debut full-length novel by Australian author, MG Hunt.\u003c\/p\u003e","brand":"MG Hunt","offers":[{"title":"Signed","offer_id":42519779278938,"sku":null,"price":38.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/stillwatersrundeepmghunt.jpg?v=1762311394"},{"product_id":"elara-and-the-passing-mg-hunt","title":"Elara and The Passing - MG Hunt","description":"\u003cp\u003eThe wind has mysteriously stopped in the township of Shinvik; a remote settlement located in the far-off Western Isles.\u003c\/p\u003e\n\u003cp\u003eA young explorer, Elara, is tasked with investigating the strange meteorological phenomenon.\u003cbr\u003eInstructed by the town’s authorities, Elara uses her nature magik to traverse a perilous mountain pass. It is a passage where no one has ever returned from.\u003c\/p\u003e\n\u003cp\u003eEvery traveller who has begun their trek from Shinvik has never returned.\u003c\/p\u003e\n\u003cp\u003eWhat Elara discovers on her journey through the pass will change her life forever.\u003c\/p\u003e","brand":"MG Hunt","offers":[{"title":"Signed","offer_id":42519830069338,"sku":null,"price":10.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/afc79286-b22a-4d1e-9029-e23383c4448a.jpg?v=1762403568"},{"product_id":"electrifying-awakening-sara-petrie","title":"Electrifying Awakening - Sara Petrie","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"r27e7i-7g9vtu-rsdwwd-cyn09e\" data-cel-widget=\"productTitle\"\u003eFirst Living High Nymph Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eWhen the darkness comes, it will be all-consuming, swallowing you whole until nothing is left; the light in your heart erased. When the time is near, the hidden blood will end the Titans.(The Prophecy of the Fates)\u003c\/p\u003e\n\u003cp\u003eDo you ever wonder what it would be like if magic suddenly turned your whole life upside down? Meet Juno – a sassy detective and slightly crazy mom. Her very soul burned alive, awakening her inner High Nymph.\u003c\/p\u003e\n\u003cp\u003eIn this intriguing contemporary fantasy with a why-choose twist, Juno needs to bind her Titans - all freakin’ five of them; and finds some more willing than others. Irresistible men start popping up; Fae folk claim they are her fated mate Titans.\u003c\/p\u003e\n\u003cp\u003eOne tiny issue with that - she’s already married!\u003c\/p\u003e\n\u003cp\u003eHer destiny – to claim her rightful place amongst the Fae, and restore the balance. Changes in life come thick and fast. Electrifying magic she can’t quite get a grip on, and an imminent threat of self-implosion, are not even the biggest fish to fry!\u003c\/p\u003e\n\u003cp\u003eWith the clock ticking, Juno tries to get a grip on this magical whirlwind. She seeks refuge with her husband Jay, and the ‘Queer Cheer’, her ensemble of quirky friends. She resolves to fake it ‘til she makes it… because if she fails?\u003c\/p\u003e\n\u003cp\u003e—A reign of darkness hovers over them all.\u003c\/p\u003e","brand":"Sara Petrie","offers":[{"title":"Book 1 With Artwork","offer_id":42519834755162,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":false},{"title":"Book 1 \u0026 2 With Artwork","offer_id":43413357428826,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/electrifyingawakeningsarapetrie.jpg?v=1762311910"},{"product_id":"binding-the-five-sara-petrie","title":"Binding the Five - Sara Petrie","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"x1dds2-7xjxbv-yx51yc-yb5kgi\" data-cel-widget=\"productTitle\"\u003eFirst Living High Nymph Book #2\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003eEmbrace the darkness, bind the five, for they will reveal the hidden blood. The Balance restores as the Queen returns. The time is now.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eFollowing her electrifying awakening (book 1), Juno finds herself immersed in the realm of Fae with three of her fated mates. Darkness is upon them sooner than anticipated, making our sassy nymph anxious, as she barely grasps her vast newfound powers.\u003c\/p\u003e\n\u003cp\u003eNew alliances are forged, and old ones are tested. Vampires, blood witches, fae and wolf shifters, prove friend or foe in the chaos that upturns Earth.\u003c\/p\u003e\n\u003cp\u003eHow is our Chosen One supposed to find her missing Titans when evil roams the Realms? And what will it cost to bind the five in time to prevent a reign of Darkness?\u003c\/p\u003e\n\u003cp\u003eThe Queen returns you little shits! It’s time the monsters pay.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eThis is the twist-riddled second book in the three-book First Living High Nymph series, concluded with Soaring High as the grand finale.\u003c\/p\u003e","brand":"Sara Petrie","offers":[{"title":"With Artwork","offer_id":42519837147226,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/bindingthefivesarapetrie.jpg?v=1762312126"},{"product_id":"the-lost-lady-of-the-darkwoods-a-l-rojo","title":"The Lost Lady of the Darkwoods - A L ROJO","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"m1227w-ali2m7-br7mdw-kqztfw\" data-cel-widget=\"productTitle\"\u003eShifters of Azanir Series Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eIt’s been ten years since I ran away.\u003c\/p\u003e\n\u003cp\u003eFor ten years, I’ve been living in the human realm, trying to find somewhere to belong. I’ve carved out a life for myself with my foster family, and I’m happy. At least, as happy as I can be.\u003c\/p\u003e\n\u003cp\u003eI’m half human and half Azanite. A shifter who can’t shift. An abomination who hates to fall asleep because her dreams are full of death and destruction, and potential prophecies. Frankly, I’m a mess.\u003c\/p\u003e\n\u003cp\u003eI thought I escaped my old life. Until, my foster brother and I are attacked. Then everything spirals out of control.\u003c\/p\u003e\n\u003cp\u003eThey found me. Four powerful, intimidating and unbelievably gorgeous Drengar. The Drengar are scary shifter warriors from my birth lands. They’re on a mission to find a sacred text that was stolen from Azanir and I don’t know if I believed it when they told me they found me by accident. They thought I was dead. The lost Lady of the Darkwoods.\u003c\/p\u003e\n\u003cp\u003eI was a fool to think that I could live in peace away from the demons that haunt our kind and from the laws of my people. I got ten years, I guess I have to be grateful for that. I sacrificed everything to save my foster brother, and for him, I’d give up my freedom and my life. Now, I’m stuck on a road trip with four Drengar who challe\u003c\/p\u003e","brand":"A L ROJO","offers":[{"title":"Signed","offer_id":42519990632538,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/thelostladyofthedarkwoodsalrojo.jpg?v=1762313230"},{"product_id":"secrets-on-the-sea-shona-knight","title":"Secrets on the Sea - Shona Knight","description":"\u003ch3\u003e\u003cstrong\u003eThe Lost Souls Of Dyconia Book #1\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong\u003e*STANDALONE story in a shared world*\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eDisguised as a cabin boy on a pirate ship with three sexy captains, one woman is about to sail into uncharted waters of passion, danger, and a secret that could change everything.\u003c\/p\u003e\n\u003cp\u003eRia\u003c\/p\u003e\n\u003cp\u003eAll my life, I’ve chased the thrill of new adventures, but nothing scratches that itch for long. So when a mysterious business card slips under my apartment door, promising to grant my greatest wish, my curiosity and sense of adventure get the best of me.\u003c\/p\u003e\n\u003cp\u003eBefore I know it, I’ve switched places with my look-alike and whisked through the Enchanted Veil to a whole new realm. But in this strange, medieval place, men vastly outnumber women and they don’t take kindly to the word ‘no’. To survive, I disguise myself as a man and get a job aboard a pirate ship run by three handsome brothers.\u003c\/p\u003e\n\u003cp\u003eHuxley, Calix and Bazz are demanding and intimidating, but also incredibly kind and sexy. The battles raging on the seas are nothing compared to the reckless, growing desire building inside me. But if they find out I’m not who I say I am, I fear they’ll treat me like the commodity women are in this realm, or worse, leave me alone and brokenhearted.\u003c\/p\u003e\n\u003cp\u003eSailing on the high seas, disguised as a man with three dangerously captivating pirate captains, what could go wrong?\u003c\/p\u003e\n\u003cp\u003e***This is a standalone, lighthearted, why choose MFMM romance with a fantasy twist and no bullying, cheating, owd, mm, or ff. Each book in this standalone series focuses on new characters, but reading in order is recommended. Contains strong language, violence, and consensual sexual content. Trigger warnings available at ShonaKnight.com.\u003cbr\u003e\u003c\/p\u003e","brand":"Shona Knight","offers":[{"title":"Signed Bookplates","offer_id":42520009048154,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/secretsontheseashonaknight.jpg?v=1762313448"},{"product_id":"sparrow-in-the-woods-shona-knight","title":"Sparrow in the Woods - Shona Knight","description":"\u003ch3\u003e\u003cstrong\u003eThe Lost Souls Of Dyconia\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong\u003e*STANDALONE story in a shared world*\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eBroken, scared, and running from her abusive past, the last thing Odessa expects is the chance to escape to a new world, but what if the men in that world are determined to break her for good?\u003c\/p\u003e\n\u003cp\u003eOdessa\u003c\/p\u003e\n\u003cp\u003eGrowing up a social pariah, my parents were the only bright spot in my life. So when they suddenly pass away, I’m left on my own, with a broken heart. That is, until he shows up.\u003c\/p\u003e\n\u003cp\u003eHe swoops in with his charming personality and dashing good looks, wasting no time to stake his claim on me. If only I had known then that I was about to step into the viper’s nest. It takes me three years to escape his abusive grasp, sneaking away in the dead of night.\u003c\/p\u003e\n\u003cp\u003eOn the run, and constantly looking over my shoulder, I’m barely able to make ends meet. So when I’m given an offer I can’t refuse, to travel to another world and get beyond his reach, I take the leap, no matter how unbelievable it sounds.\u003c\/p\u003e\n\u003cp\u003eBut things in this new world aren’t what I expect, and I soon find myself in the hands of a group of bandits. The four brothers who lead them are fierce, determined and painstakingly gorgeous. And they think I’m their enemy.\u003c\/p\u003e\n\u003cp\u003eThese men seem to make it their mission to break me, and this time, I’m afraid they will finally succeed.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e***This is a dark, standalone, why choose MFMM+ romance with a fantasy twist and no cheating, owd, mm, or ff. Each book in this standalone series focuses on new characters, but reading in order is recommended. Contains dark themes, strong language, violence, and consensual sexual content. Trigger warnings available at ShonaKnight.com.\u003c\/p\u003e","brand":"Shona Knight","offers":[{"title":"Signed Bookplates","offer_id":42520010883162,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/sparrowofthewoodsshonaknight.jpg?v=1762313547"},{"product_id":"searching-for-her-heart-shona-knight","title":"Searching for Her Heart - Shona Knight","description":"\u003ch3\u003e\u003cstrong\u003eThe Lost Souls of Dyconia Book #3\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong\u003e*STANDALONE story in shared world*\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eSent to a dangerous realm in search of her best friend, Penny starts collecting injuries almost as quickly as she starts collecting mates. But will these protective men stand by her when they uncover her deepest fears?\u003c\/p\u003e\n\u003cp\u003ePenny\u003c\/p\u003e\n\u003cp\u003eAfter losing my twin brother and my parents, Ria is the only family I have left in this world. So when she disappears, I’m willing to do anything to find her—even if it means being sent to an entirely different realm.\u003c\/p\u003e\n\u003cp\u003eAt first, Dyconia feels like something out of the past, but I quickly realize this world is far more dangerous, and captivating, than I ever imagined. With men riding giant eagles, strange creatures roaming the land, and the fact that there are far fewer women than men, it’s unlike anything I’ve ever seen.\u003c\/p\u003e\n\u003cp\u003eThrough a series of near death incidents (totally not my fault), I meet Ryker, the charming, handsome eagle rider, and Braxton, the giant mountain man. I didn’t expect to fall for them so quickly, but what’s even more surprising is that they think I need more than just the two of them to keep me safe in this dangerous world.\u003c\/p\u003e\n\u003cp\u003eIn our search for my best friend, Ria, we meet more men who seem determined to find their own place in my heart. I can’t deny my pull towards them, but I can’t forget my main reason for being here. But along the way, I start to realize that maybe love is something worth finding, too.\u003c\/p\u003e\n\u003cp\u003e***This is a standalone, lighthearted, why choose MFMM+ romance with a fantasy twist and no bullying, cheating, owd, mm, or ff. Each book in this standalone series focuses on new characters, but since this story is about Penny's search for Ria, you may enjoy it more if you read Ria's story first (Secrets on the Sea). Contains strong language, violence, and consensual sexual content. Trigger warnings available at ShonaKnight.com\u003c\/p\u003e","brand":"Shona Knight","offers":[{"title":"Signed Bookplates","offer_id":42520011669594,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/searchingforherheartshonaknight.jpg?v=1762313718"},{"product_id":"taken-by-her-princes-shona-knight","title":"Taken by Her Princes - Shona Knight","description":"\u003ch3\u003e\u003cstrong\u003eThe Lost Souls of Dyconia Book #4\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong\u003e*STANDALONE story in shared world*\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eWaking up in a strange world should be the strangest thing to happen to Freya. But what’s even more surprising are the five princes who barge in claiming to be her husbands, who hate her, and they’ve come to collect on what they believe she owes them - an heir.\u003c\/p\u003e\n\u003cp\u003eFreya\u003c\/p\u003e\n\u003cp\u003eMy life has never been easy. Growing up in foster care, I was constantly adopted and returned, thanks to my unique ability. Nobody wanted to keep the weird girl who could magically heal animals. But that didn’t mean I wanted to leave my world completely.\u003c\/p\u003e\n\u003cp\u003eUnfortunately, the decision is out of my hands when I wake up in a strange medieval world filled with ogres, trolls and knights. Before I can process where I am, I’m taken by five princes.\u003c\/p\u003e\n\u003cp\u003eThese men not only think I’m their wife, a princess who they apparently hate, but they had an agreement to come get her in a year, to produce an heir. And the time to collect is now.\u003c\/p\u003e\n\u003cp\u003eWhile we travel through Dyconia to their castle in the North, I try everything I can to convince them that I’m not from this world, and along the way, I unexpectedly find myself falling for them. I start to realize I no longer wish to wake up back in my own world, instead, I fear it.\u003c\/p\u003e\n\u003cp\u003eBut how can I build a life with my princes if I might, one day, switch places with my doppelganger again, and lose them forever?\u003c\/p\u003e\n\u003cp\u003e***This is a standalone, enemies to lovers, why choose MFMM+ romance with a fantasy twist and no bullying, cheating, owd, mm, or ff. Each book in this standalone series focuses on new characters, but reading in order is recommended. Contains strong language, violence, and consensual sexual content. Trigger warnings available at ShonaKnight.com\u003c\/p\u003e","brand":"Shona Knight","offers":[{"title":"Signed Bookplates","offer_id":42520015110234,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/takenbyherprincesshonakngiht.jpg?v=1762313822"},{"product_id":"quest-for-her-knights-shona-knight","title":"Quest for Her Knights - Shona Knight","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"xhr2z-7coz0e-4ymyit-xtucb0\" data-cel-widget=\"productTitle\"\u003eThe Lost Souls of Dyconia Book #2\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong\u003e*STANDALONE story in shared world*\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eThrown into an unknown realm and mistaken for the princess, Elora is shocked to find she’s being forced to marry men of noble blood. But it’s the knights sworn to protect her that she has her eye on, and they’re completely off-limits.\u003c\/p\u003e\n\u003cp\u003eElora\u003c\/p\u003e\n\u003cp\u003eOne minute I’m complaining about the lack of decent men, and the next I’m dragged through a portal to a realm with a serious shortage of women.\u003c\/p\u003e\n\u003cp\u003eMistaken for the princess, I’m told I must find a harem worthy of royalty. The kings and queen send me out into Dyconia to meet the lords who are begging to win my favor—but the only men I want are the very ones I’ve been forbidden to touch.\u003c\/p\u003e\n\u003cp\u003eThe knights who guard me are everything I’ve ever craved; fierce, loyal, and entirely off-limits. We’re getting too close. They know it. I know it.\u003c\/p\u003e\n\u003cp\u003eAnd if we give in to temptation, it won’t just break their vows.\u003cbr\u003eIt could cost us our lives.\u003c\/p\u003e\n\u003cp\u003e***This is a standalone, why choose MFMM romance with a fantasy twist and no bullying, cheating, owd, mm, or ff. Each book in this standalone series focuses on new characters, but reading in order is recommended. Contains strong language, violence, and consensual sexual content. Trigger warnings available at ShonaKnight.com\u003c\/p\u003e","brand":"Shona Knight","offers":[{"title":"Signed Bookplates","offer_id":42520015863898,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/questforherknightsshonaknight.jpg?v=1762313985"},{"product_id":"echoes-of-blood-and-bone-s-e-zell","title":"Echoes of Blood and Bone -  S E Zell","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"oz5khi-tx77hq-5mm40l-2d309e\" data-cel-widget=\"productTitle\"\u003eThe Broken Barrier Legacy Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eSometimes the darkness is safer than the light...\u003c\/p\u003e\n\u003cp\u003eA Key.\u003cbr\u003eMina is being followed. She's felt eyes tracking her for days. On her college campus, at the haunted house where she works for extra cash...Whoever it is, she can feel their intent vacillating between two different kinds of need--hunger and desperation. She's always had uncanny intuitions about people. Intuitions her English professor father always warns her to keep to herself. It's his one rule. Act normal at all costs. Tell no one. But it seems to Mina that someone already knows. And it might be too late to run.\u003c\/p\u003e\n\u003cp\u003eAn immortal.\u003cbr\u003eEnoch has searched the human realm for more than two thousand years for the Keys to unlock the Barrier. Seven Keys. Seven bloodlines of the original humans who cast the spell that rent the world in two. He needs one more. Now, finally, he has found her. A college student. Untrained. Unaware of who she really is. His desperation for what she can help him accomplish grows by the day, but he has to be careful. Enoch is not the only one after her. And he's not the only one watching...waiting.\u003c\/p\u003e\n\u003cp\u003eA broken heart.\u003cbr\u003eAlejandro had the world at his feet until he was twelve. One night, two deaths, and everything changed. Now, his ambitious mother drags him secretly across an ocean to meet a girl he's never even heard of. Mamá says the power Mina contains as a Key could be enough...enough to bring back the one person who means anything to Alejo. But using Mina's power for this kind of magic may mean taking her life. After meeting her, Alejo isn't sure it's a fair trade anymore.\u003c\/p\u003e\n\u003cp\u003eAnd a ghost.\u003cbr\u003eElyse has been friends with Mina Voorsanger since who knows when. She's always thought her friend was a little weird, but Mina's ability to decipher Elyse's intentions when no one else can means Elyse is ride or die for that bitch. Ride or die. She always thought that was just an expression. Of course, the world would go ahead and prove her wrong\u003c\/p\u003e","brand":"S E Zell","offers":[{"title":"Default Title","offer_id":42520307007578,"sku":null,"price":31.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_7_da219a70-b636-449a-898b-7d4918798a25.png?v=1779692904"},{"product_id":"memory-and-mutiny-s-e-zell","title":"Memory and Mutiny -  S E Zell","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"g1jr75-375z9p-z429vr-erixg6\" data-cel-widget=\"productTitle\"\u003eJesimae Series Book\u003cspan\u003e #2\u003c\/span\u003e\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003eAshdan's memory is gone. She can't remember her family, friends, or loved ones. All she knows is she does the King's bidding. Fights who he says to fight. Kills who he says to kill. Obey at all costs or the one friend she does remember will be executed. One night, as she's carrying out another of the King's orders, she realizes she's being watched. She attacks the stalker and pins him to the ground, intending to do away with the potential enemy, only - she knows that face.\u003c\/p\u003e\n\u003cp\u003eCrown Prince Emyr has been locked away in his palace rooms since being \"rescued\" by his father's men several months ago. The friends he made are either dead or on the run. A family scandal surrounding his birth is threatening to reveal itself and burst from his skin. The woman he lov- well, she was executed by his father for her part in his kidnapping. Few things are going right in the Prince's world until one night when wandering the palace gardens, he watches the cleanest, swiftest, most silent murder he's ever seen. Her elegant dress isn't even wrinkled as she lays the corpse on the ground and suddenly he knows. She might be wearing a different face thanks to her shapeshifting powers, but he knows it's Ashdan. She's still alive.\u003c\/p\u003e\n\u003cp\u003eA star-crossed romance, a mad king, a found family, and a political coup. Memory and Mutiny is the epic next installment to the Jesimae series by S.E. Zell.\u003c\/p\u003e\n\u003cp\u003eContent warnings for violence, s*x, and cursing\u003c\/p\u003e","brand":"S E Zell","offers":[{"title":"Default Title","offer_id":42520480251994,"sku":null,"price":31.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_25.png?v=1779343706"},{"product_id":"a-curse-of-fate-s-e-zell","title":"A Curse of Fate - Jaymin Eve","description":"\u003ch3\u003e\u003cem\u003e\u003cstrong\u003eShifter City Fated Mates Book #1\u003c\/strong\u003e\u003c\/em\u003e\u003c\/h3\u003e\n\u003cp\u003eA new romantasy from Wall Street Journal and USA Today bestseller Jaymin Eve.\u003c\/p\u003e\n\u003cp\u003eI'm a shifter who can never bond with a pack. Not if I want to live.\u003c\/p\u003e\n\u003cp\u003eThe day I watched my mom's pack destroy her, was the day I knew I had to run from the shifter cities.\u003c\/p\u003e\n\u003cp\u003eMom and I share the same designation, which means we'll share the same fate.\u003c\/p\u003e\n\u003cp\u003eFor ten years I hide from the cities and the alphas who control them.\u003c\/p\u003e\n\u003cp\u003eUntil my luck runs out.\u003c\/p\u003e\n\u003cp\u003eDragged to Golden Claw against my will, they charge me as a rogue. I'm facing death until one of the strongest alphas in the city scents me as his match.\u003c\/p\u003e\n\u003cp\u003eScents me... and claims me.\u003c\/p\u003e\n\u003cp\u003eEven worse? He's part of the most powerful pack of alphas the cities have ever seen.\u003c\/p\u003e\n\u003cp\u003eI have to reject them. It's the only way to avoid my mom's curse of fate. And my own.\u003c\/p\u003e\n\u003cp\u003eExcept, these alphas have never been rejected a day in their lives, and they're definitely not about to start now.\u003c\/p\u003e\n\u003cp\u003e* This is a why choose romance with very dominant and possessive male main characters. The female main character will not choose between the love interests. Please note, Shifter City is not omegaverse. It's a shifter romance.\u003c\/p\u003e\n\u003cp\u003e* This story is a full length (95k words) romantasy and contains adult themes and descriptions that are suitable for 18+.\u003c\/p\u003e","brand":"Jaymin Eve","offers":[{"title":"Default Title","offer_id":42520501026906,"sku":null,"price":31.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/acurfseoffatejaymineve.jpg?v=1762319144"},{"product_id":"a-song-of-death-c-m-quinn","title":"A Song of Death - C M Quinn","description":"\u003ch3\u003e\u003cspan style=\"font-size: 0.875rem;\"\u003eThe Purgatory Chronicles Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003ePurgatory is a haven or so Elaine Tormelin believed.\u003c\/p\u003e\n\u003cp\u003eAya Sinclair swore never to protect a witch, but fate demanded otherwise.\u003c\/p\u003e\n\u003cp\u003eForced into an uneasy alliance, Elaine is swept into a dangerous mission, a growing conspiracy and a fight to claim the home she hungers for. All the while, she finds herself unexpectedly drawn to her newfound ‘protector’ who may or may not want her dead.\u003c\/p\u003e\n\u003cp\u003eAccompanied by a prickly demon and a protective werewolf, the fight has only begun…and it's about to get bloody.\u003c\/p\u003e\n\u003cp\u003e**Full CW available within the book and at cmquinnauthor.com\u003c\/p\u003e","brand":"C M Quinn","offers":[{"title":"Signed","offer_id":42521352175706,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/asongofdeathcmquinn.jpg?v=1762324177"},{"product_id":"a-ballad-of-betrayal-c-m-quinn","title":"A Ballad of Betrayal - C M Quinn","description":"\u003ch3\u003e\u003cstrong\u003eThe Purgatory Chronicles Book #2\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eThe sequel to A Song of Death!\u003c\/p\u003e\n\u003cp\u003eFinding a home was only the start. Now it’ll be a war with the gods to keep it.\u003c\/p\u003e\n\u003cp\u003eReeling from betrayals and their last battle, Aya and Elaine are thrust into a race for survival. A crack has appeared in the barrier guarding their home, and if it falls, everyone within will die.\u003c\/p\u003e\n\u003cp\u003eAs all they know unravels around them, and ancient destinies spill into the light, they must embrace who they were always meant to become—or die trying.\u003c\/p\u003e","brand":"C M Quinn","offers":[{"title":"Signed with Bonus Art","offer_id":42521358041178,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/aballadofbetrayalcmquinn.jpg?v=1762324427"},{"product_id":"souls-and-spirits-isabelle-fleay","title":"Mystic City - Isabella Fleay","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"5uxd3b-x6h1eu-2d657c-k8gvnx\" data-cel-widget=\"productTitle\"\u003eMystic City Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"5uxd3b-x6h1eu-2d657c-k8gvnx\" data-cel-widget=\"productTitle\"\u003e*Souls and Spirits*\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eIn Arcadia, a city alive with magic and teeming with vampires, angels, witches, and werewolves, Leila Starquin has always been the exception—a human girl living an ordinary life in an extraordinary world. She’s spent her days navigating classes and her nights wrapped in laughter and carefree revelry, content to enjoy the wonder around her without being a part of it.\u003c\/p\u003e\n\u003cp\u003eBut everything changes the night she stumbles onto a crime scene. Souls are being devoured—ripped away before they can pass on—and no one knows who, or what, is behind it. Suddenly, Leila finds herself under the watchful eye of Grim, a brooding and mysterious shepherd of souls tasked with keeping the afterlife in balance. Grim is convinced Leila’s presence at the scene is no accident, and worse—she might be the key to the growing chaos.\u003c\/p\u003e\n\u003cp\u003eDesperate to prove her innocence, Leila joins forces with Grim, plunging herself into the depths of Arcadia’s secrets. Together, they hunt an elusive soul eater, treading dangerous ground where shadows hide truths and alliances can’t be trusted. But the more she uncovers, the more Leila begins to realize that her ordinary life might not have been so ordinary after all.\u003c\/p\u003e\n\u003cp\u003eAs her connection to Grim deepens, and as the mysteries surrounding the city—and herself—begin to unravel, Leila is faced with impossible choices. The fate of Arcadia rests on a balance she never asked to tip, and the answers she seeks might change everything.\u003c\/p\u003e\n\u003cp\u003ePerfect for fans of Crescent City and The Shadowhunter Chronicles, Mystic City blends urban fantasy, slow-burn romance, and heart-pounding mystery into an unforgettable story about love, loss, and the courage to face who you really are.\u003c\/p\u003e","brand":"Isabelle Fleay","offers":[{"title":"Signed","offer_id":42521526206554,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/soulsandspiritsisabellafleay.jpg?v=1762325172"},{"product_id":"shades-of-smoke-and-shadows-celia-ralk","title":"Shades of Smoke and Shadows - Celia Ralk","description":"\u003ch3\u003e\u003cstrong\u003eCrooked Crowns Book #1\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eWhen strange marks appear on Clara Afron's body, this is what she\u003cbr\u003efears most. The whispers and prophecies of nightmares and terror.\u003cbr\u003eAfter successfully ignoring the marks for almost a year,\u003cbr\u003eClara is thrown back into a world of uncertainty.\u003cbr\u003eThe ruthless king takes her into his castle, under his soldiers' wings\u003cbr\u003eand has his staff teach her and train her, clothe her and feed her.\u003cbr\u003eKeep her safe.\u003c\/p\u003e\n\u003cp\u003eBut Clara doesn't know who to trust - not with her secrets or her abilities,\u003cbr\u003emuch less her life. As relationships grow\u003cbr\u003eand power builds, secrets are shared, but there are more questions\u003cbr\u003ethan answers and the illusion of safety is shattered.\u003c\/p\u003e\n\u003cp\u003eClara fights to stay alive but her life quickly becomes a tailspin of\u003cbr\u003ebeautiful, powerful, welcome darkness.\u003c\/p\u003e","brand":"Celia Ralk","offers":[{"title":"Signed Book 1","offer_id":42521676415066,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":false},{"title":"Signed Book 1 \u0026 Book 2","offer_id":43413288091738,"sku":null,"price":55.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/shadesofsmokeandshadowsceliaralk.jpg?v=1762325639"},{"product_id":"dreams-of-debt-and-deities-celia-ralk","title":"Dreams of Debt and Deities - Celia Ralk","description":"\u003ch3\u003e\u003cstrong\u003eCrooked Crowns Book #2\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eClara is tired of being surrounded by death and destruction, though she is not\u003cbr\u003eopposed to murder. Her hunger for blood is insatiable and she’s all too willing to give in.\u003cbr\u003eDesire to end those who have wronged her fills Clara's every need and leaves her\u003cbr\u003euncaring of the consequences.\u003c\/p\u003e\n\u003cp\u003eBut consequences will come.\u003c\/p\u003e\n\u003cp\u003eA sister she never wanted, or needed, inserts herself into Clara’s life. A forbidden\u003cbr\u003elove finds itself trapped in a tantalising web just beyond her grasp. An unexpected\u003cbr\u003ealliance with the Prince attracts new blessings - and curses.\u003c\/p\u003e\n\u003cp\u003eThe prophecy of carnage and destruction sparks more fear and confusion -\u003cbr\u003ebut she will not be deterred. Not now, when more magic and power than she’s\u003cbr\u003eever known surges through Clara’s veins.\u003c\/p\u003e\n\u003cp\u003eEmotions run high as she fights for her life and for the hearts of those she loves\u003cbr\u003eto remain beating.\u003c\/p\u003e\n\u003cp\u003eWAR IS COMING.\u003cbr\u003eIN ALL ITS VIOLENTLY DELIGHTFUL,\u003cbr\u003eDESPERATE GLORY.\u003c\/p\u003e","brand":"Celia Ralk","offers":[{"title":"Signed","offer_id":42521732022362,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/dreamsofdebtanddeitiesceliaralk.jpg?v=1762325746"},{"product_id":"whispers-in-the-blood-s-k-may","title":"Whispers in the Blood - S K May","description":"\u003ch3\u003e\u003cstrong\u003eThe Whispers Series Book #1\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eEntire countries were destroyed when the nuclear war started. The vampires never wanted to reveal their existence, but they took control of the world to ensure that it survived.\u003c\/p\u003e\n\u003cp\u003eLarissa lives a sheltered life in a small town, where she's grown to accept the life laid out for her. After the sudden tragic death of her mother, her sister, Lucianna, convinces her to move to London so they can both have a fresh start. She agrees, ignoring the warnings from those close to her.\u003c\/p\u003e","brand":"S K May","offers":[{"title":"Signed","offer_id":42521768329306,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/whispersinthebloodskmay.jpg?v=1762325877"},{"product_id":"whispers-from-the-curse-s-k-may","title":"Whispers from the Curse - S K May","description":"\u003ch3\u003e\u003cstrong\u003eThe Whispers Series Book #2\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eIn the aftermath of a brutal attack, Larissa finds herself in the arms of an unexpected saviour. As she begins to unravel a web of dark secrets that threaten her very existence, Nik is determined to protect her, enlisting the help of his brother, Roman.\u003c\/p\u003e\n\u003cp\u003eWhile grappling with the shocking truth about her parents, Larissa becomes increasingly entangled in a perilous curse. Balancing her responsibilities at Refresh Marketing with the chaos surrounding her, she feels the crushing weight of the world.\u003c\/p\u003e\n\u003cp\u003eNik's devotion is unwavering; he vows to keep Larissa safe at all costs, even if it means proposing marriage sooner than expected. He suspects her mother's death was no accident and that a sinister force is orchestrating events from the shadows.\u003c\/p\u003e\n\u003cp\u003eWith threats emerging from unexpected places-friends turned foes, vengeful witches, and lurking werewolves-Larissa and Nik must navigate a treacherous landscape of betrayal and magic. Will they uncover the secrets hidden in the darkness, or will Larissa ultimately succumb to the curse?\u003c\/p\u003e","brand":"S K May","offers":[{"title":"Signed","offer_id":42521819086938,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/whispersfromthecurseskmay.jpg?v=1762325947"},{"product_id":"the-crystal-dynasty-a-kingdom-divided-abigail-mader","title":"A Kingdom Divided - Abigail Mader","description":"\u003ch3\u003e\u003cstrong\u003eThe Crystal Dynasty Book #1\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eA great treachery. A kingdom torn asunder. A dethroned queen seeking justice.\u003cbr\u003eFor a millennium, the prosperous land of Ethos revelled in the protection of the Divine Spirit and the unshakeable bond of the Royal Family. But all that changed with a devastating betrayal within the monarchy.\u003cbr\u003eConsumed by the desire to rule, the king's older sister, Elinor, kills the king and imprisons the queen. Firmly seated on her new throne, Elinor craves absolute power and fixates on reassembling the lost magical shards of Ethos. With them, she will become the supreme ruler.\u003cbr\u003eIn the wake of treachery, the young twins are forced to flee, finding refuge in the care of their mystical grandfather. The looming question is whether he can shield them from the clutches of the ruthless traitor queen, or if their mother, the imprisoned queen, can escape to reunite with her children.\u003cbr\u003eBelieving her family dead, all hope seems lost for Cecilia. But when the high priestess visits her with news of her twins, she is filled with new life and determination. Planning a daring escape, she knows she must getaway. It's the only way to protect her children and save Ethos from a vindictive and heartless tyrant, Elinor.\u003cbr\u003eThe one who reunites the crystal shards will reign supreme.\u003c\/p\u003e","brand":"Abigail Mader","offers":[{"title":"Signed with Art Book 1","offer_id":42522661519450,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":true},{"title":"Signed with Art Book 1 \u0026 Book 2","offer_id":43413275115610,"sku":null,"price":55.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/thecrystaldynastyakingdomdividedabigailmader.jpg?v=1762327623"},{"product_id":"bonded-chaos-k-j-johnson","title":"Bonded Chaos - K J Johnson","description":"\u003ch3\u003e\u003cem\u003e\u003cstrong\u003eTwisted Fates Book #1\u003c\/strong\u003e\u003c\/em\u003e\u003c\/h3\u003e\n\u003cp\u003eThe one man who wouldn’t hesitate to kill me if he discovered the truth about me… believed he was my mate.\u003c\/p\u003e\n\u003cp\u003eIt was a fleeting moment.\u003c\/p\u003e\n\u003cp\u003eA chance encounter that would slip away like so many before it.\u003c\/p\u003e\n\u003cp\u003eOr so Cadence thought.\u003c\/p\u003e\n\u003cp\u003eBut when she woke imprisoned in the Unseelie Kingdom, with no memory of how she got there, and no way to escape, she soon realized that fate had other plans for her.\u003c\/p\u003e\n\u003cp\u003eCadence\u003c\/p\u003e\n\u003cp\u003eMy life was simple. I ran the apothecary in my village, cared for my parents, and tried to keep my reckless brother out of trouble.\u003c\/p\u003e\n\u003cp\u003eI hid in the shadows of the unremarkable, blending seamlessly into the background, unnoticed and overlooked.\u003c\/p\u003e\n\u003cp\u003eIt was safer that way.\u003c\/p\u003e\n\u003cp\u003eThat was, until he walked into the marketplace, with his storm-grey eyes and a smirk that was as sinful as it was dangerous. His presence stole my breath away, and the overwhelming urge to run consumed me.\u003c\/p\u003e\n\u003cp\u003eTo him, or from him? I didn’t know.\u003c\/p\u003e\n\u003cp\u003eRyker\u003c\/p\u003e\n\u003cp\u003eThe moment I laid eyes on her, she became mine.\u003c\/p\u003e\n\u003cp\u003eMy Temptress.\u003cbr\u003eMy Mate.\u003c\/p\u003e\n\u003cp\u003eThe more Cadence tried to fight me, the more desperate I became to conquer her.\u003c\/p\u003e\n\u003cp\u003eIt’s a slow descent into madness.\u003c\/p\u003e\n\u003cp\u003eA pull I’m unable to resist, even though it threatens to bring me to the edge of myself. I know it will tear me apart. Yet, I would never escape it, because in the darkness she is mine, and mine alone.\u003c\/p\u003e","brand":"K J Johnson","offers":[{"title":"Signed","offer_id":42523631485018,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/bondedchaoskjjohnson.jpg?v=1762330449"},{"product_id":"a-heart-of-fire-and-flame-k-j-johnson","title":"A Heart of Fire and Flame - K J Johnson","description":"\u003ch3\u003eFire and Flame Book #1\u003c\/h3\u003e\n\u003cp\u003eA dark, seductive Rumpelstiltskin retelling.\u003c\/p\u003e\n\u003cp\u003eShe was promised to the realm. He took her for himself.\u003c\/p\u003e\n\u003cp\u003eHarlowe\u003c\/p\u003e\n\u003cp\u003ePeace between Valoren and Pyrithia was always an illusion — a truce balanced on a knife’s edge.\u003c\/p\u003e\n\u003cp\u003eSo when Pyrithia’s infamous dragon riders cross our borders uninvited, I’m ready to fight to my last breath.\u003c\/p\u003e\n\u003cp\u003eWhat I wasn’t ready for... was him.\u003c\/p\u003e\n\u003cp\u003eDespite my mistrust, I can’t help feeling drawn to the enigmatic, sexy-as-sin General of the Cathal.\u003c\/p\u003e\n\u003cp\u003eSilas can be summarized in three words: Dangerous. Deadly. Deceitful.\u003c\/p\u003e\n\u003cp\u003eI know better than to trust a man whose smile is as sharp as the blade he keeps hidden.\u003c\/p\u003e\n\u003cp\u003eYet the pull between us is undeniable.\u003c\/p\u003e\n\u003cp\u003eTrust is lethal — but desire might just be worse.\u003c\/p\u003e\n\u003cp\u003eSilas\u003c\/p\u003e\n\u003cp\u003eShe’s a pawn in a game she doesn’t understand.\u003c\/p\u003e\n\u003cp\u003eAnd yet, I want to possess her... to own her... to make her mine.\u003c\/p\u003e\n\u003cp\u003eBut I’m not the only one hunting her.\u003c\/p\u003e\n\u003cp\u003eThe realm hangs in the balance, but not everything is as it seems.\u003c\/p\u003e\n\u003cp\u003eAttacks are coming from all sides and Harlowe must decide how far she is willing to go to reclaim the life that was stolen from her.\u003c\/p\u003e\n\u003cp\u003eDragons guard the skies. Lies rot the throne. And a love like theirs could burn it all down.\u003c\/p\u003e\n\u003cp\u003eFans of dark fantasy romance and fairy tale retellings will devour this tale of love, betrayal, and deceit.\u003c\/p\u003e\n\u003cp\u003eThis story contains topics that may be triggering for some readers. It is recommended for mature audiences only (18+). Reader discretion is advised.\u003c\/p\u003e","brand":"K J Johnson","offers":[{"title":"Signed","offer_id":42523684241498,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/aheartoffireandflamekjjohnson.jpg?v=1762330708"},{"product_id":"infernum-kristen-dovnik","title":"Infernum - Kristen Dovnik","description":"\u003ch3\u003e\u003cstrong\u003eThe Firebird Series Book #1\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eZade, the Devil's offspring, might have some underworld responsibilities back home, but Earth is where the party's at! His band, the Masters of Hell are rocking the main stage, Zade’s life is almost perfect. It all goes to shit when Zade's ex Dominique, is kidnapped. With their relationship status still uncertain, Zade must put the partying aside as it becomes a race against time to find her.\u003c\/p\u003e\n\u003cp\u003eHerk has been watching for years, waiting for the right moment to strike. With Zade preoccupied on Earth, everything may now be finally within his grasp. With a device unknown to most of the Gods in his possession, he may be able to destroy the man who stole everything from him.\u003c\/p\u003e\n\u003cp\u003eWill Zade be able to save Dominique before the device is unleashed? Or will Herk get his revenge?\u003c\/p\u003e","brand":"Kristen Dovnik","offers":[{"title":"Signed Standard Paperback","offer_id":42524267872346,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true},{"title":"Signed Special Edition (Foiled)","offer_id":42524327805018,"sku":null,"price":38.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/infernumkristendovnik.jpg?v=1762332527"},{"product_id":"shadows-of-the-night-charlize-k-kelly","title":"Shadows of the Night - Charlize K Kelly","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"4yhbuh-tob84b-mv4jqr-m7xumq\"\u003eShadows of the Night Duet Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e“Nothing good ever came without sacrifice. Some of us just found clarity in the darkness of those shadows.”\u003c\/p\u003e\n\u003cp\u003e***\u003cbr\u003eNyx Monroe grew up with terrifying tales of golden-eyed beasts with nightmarish fangs and murderous tendencies but as time passed, she forgot about them, convinced they were just scary stories. When her father, Azeil Monroe, is tasked with solving the murders plaguing the coastal city of Celacali, it’s a chance at a fresh start.\u003c\/p\u003e\n\u003cp\u003eHowever, Nyx discovers everything is not what it seems beneath the veneer of the popular tourist location, also known as the City of the Dead. Something dark resides there—death and carnage reincarnate.\u003c\/p\u003e\n\u003cp\u003ePlunged into the city’s shadows, Nyx stumbles into the open arms of notorious Orion, Kotori, Niko, and Kade—the boardwalk is their blood-stained domain.\u003c\/p\u003e\n\u003cp\u003eThey’ve been waiting for twenty-five years to exact their revenge for a debt long overdue, luring Nyx and her father back to where it all began. Whilst they distract Azeil with one murder case after the other, their focus shifts to Nyx.\u003c\/p\u003e\n\u003cp\u003eSoon, there’s nowhere left for her to run—to hide—from the true beasts of legend, or from the darkness of her past.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eContent and Trigger Warnings:\u003cbr\u003eAlcohol and drug usage, assault, attempted rape, bestial violence, blood, death, divorce, emotional and physical abuse, fire, gore, gun violence, hallucinations, flashbacks, hostage and kidnapping situations, murder, profanity, PTSD, religious metaphors, sexism, sexual harassment, sexually explicit scenes, torture, violence, polyamory, BDSM, stalking, voyeurism, corruption, age gaps, exhibitionism, degradation, character deaths, threesome, knives, consensual and non-consensual biting, dubious consent\u003c\/p\u003e","brand":"Charlize K Kelly","offers":[{"title":"Signed","offer_id":42524548431962,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/shadowofthenightcharlizekelly.jpg?v=1762333689"},{"product_id":"limerence-l-s-delorme","title":"Limerence - L S Delorme","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"8xz9si-ldqu4w-uon916-a5sm2n\" data-cel-widget=\"productTitle\"\u003eThe Limerent Series Book #5\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan class=\"a-size-large celwidget\" data-csa-c-id=\"8xz9si-ldqu4w-uon916-a5sm2n\" data-cel-widget=\"productTitle\"\u003e*Interconnected Standalones*\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eKara and Dante.\u003cbr\u003eYou may not know them by name but you know them by deed. You feel them in the space between dreams and reality, in the inevitable crawl of time.\u003c\/p\u003e\n\u003cp\u003eThey have burned continents and sunk kingdoms. They’ve been worshipped and feared. Those in power call them demons. Those above power call them monsters.\u003c\/p\u003e\n\u003cp\u003eThey aren’t human but they once were. To each other, they are survivors, eternal mates and lovers. Their attraction is at the very foundation of existence.\u003c\/p\u003e\n\u003cp\u003eWhen a virus older than memory returns, Dante must find a way to contain it before it injures Kara and corrupts the fabric of reality. Ghosts vanish, worlds shift, and the laws of physics can no longer be trusted.\u003c\/p\u003e\n\u003cp\u003eAs reality collapses, the two must return to the origin of their timeline to face the Abomination that still lurks there.\u003c\/p\u003e\n\u003cp\u003eA richly woven fantasy about power, love, identity, and the weight of rewriting the world\u003c\/p\u003e","brand":"L S Delorme","offers":[{"title":"Signed Bookplates","offer_id":42524862087258,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/limerencelsdelorme.jpg?v=1762336465"},{"product_id":"the-eleventh-hour-tea-ravine","title":"The Eleventh Hour - Tea Ravine","description":"\u003ch3\u003e\u003cstrong\u003eThe Eleventh Hour Duet Book #1\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eIt’s the eleventh hour…\u003c\/p\u003e\n\u003cp\u003eMy stalker has been patiently infiltrating my life for the last six years, ever since…No, I can’t talk about that. Once upon a time, I was a normal happy woman with a fiancée and a life worth living.\u003c\/p\u003e\n\u003cp\u003eNow I exist in this hell.\u003c\/p\u003e\n\u003cp\u003eI can’t have friends, or family. My every move is tracked and monitored. I am hunted by the past. Despite my protests everything I say is ignored. I am a ghost existing in a world that hates me. There is no escape. Not for me. And all the while my moves are tracked by this threatening presence who knows things he couldn’t possibly know.\u003c\/p\u003e\n\u003cp\u003eBut all the waiting ends abruptly with the arrival of two men who bring back the agony of the past and kick start a nightmare that no one could ever imagine. Rafe and Dane have come to Hurricane to find their brother and I am the only one with the answers.\u003c\/p\u003e\n\u003cp\u003eThey bring me back to life. They give me purpose. They rekindle feelings I didn’t think I could have. After six years of stagnancy, I’m ready to find out everything. I’m ready to end this.\u003c\/p\u003e\n\u003cp\u003eI am Jax Shade…and I have the answers you seek.\u003c\/p\u003e\n\u003cp\u003eThis dark romance is a why choose romance. It is a contemporary story with paranormal elements. The bad guy is not the hero, he is not morally grey or redeemable, he is evil to his core. This novel contains a lot of triggers, and your mental health is important. Please read the warnings and proceed with caution. Enjoy…\u003c\/p\u003e","brand":"Tea Ravine","offers":[{"title":"Book 1 Signed","offer_id":42529920647258,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":false},{"title":"Book 1 \u0026 2 Signed","offer_id":43412884848730,"sku":null,"price":55.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/theeleventhhourtearavine.jpg?v=1762481190"},{"product_id":"my-monsters-keeper-tea-ravine","title":"My Monsters Keeper - Tea Ravine","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"9up0f0-4cse0i-7wxc9s-2w6byi\" data-cel-widget=\"productTitle\"\u003eMy Monsterverse Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003eThey want to eat me!\u003c\/p\u003e\n\u003cp\u003eAnd not the good kind. The actual eating kind, you know, chomp, chomp.\u003c\/p\u003e\n\u003cp\u003eThe enemy of my enemy is my friend, right? One bad day took my life, my dreams and spewed me out into a whole new reality where alphas are real. I just wish these captivating monsters would stop leering at me like that while I’m conscripted into the world's newest war: The race to save the only omegas in existance hidden right here on Earth.\u003c\/p\u003e\n\u003cp\u003eThese alphas hate each other, they are dangerous and my modern world confuses them, they are nothing like me or anyone I know. Stix, Puppy, Frost and Wilder. They should never be on the same planet together, let alone in the same house. The destruction they are capable of takes my breath away. An omega would help them find balance and control, if we could find one alive.\u003c\/p\u003e\n\u003cp\u003eBut just when I think I can give them up, the heat starts to simmer beneath my skin and these alphas stop seeing me as food…but something much more important and I’m not sure giving them up is the right thing to do.\u003c\/p\u003e\n\u003cp\u003eWhen push comes to shove and I catch whoever is responsible for waging war on my planet…they’re going to find out, it’s not my monster’s who they need to be scared of.\u003c\/p\u003e\n\u003cp\u003eIt’s their keeper.\u003c\/p\u003e","brand":"Tea Ravine","offers":[{"title":"Signed","offer_id":42530068136026,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/mymonsterskeepertearavine.jpg?v=1762482135"},{"product_id":"the-packs-request-tea-ravine","title":"The Pack's Request - Tea Ravine","description":"\u003ch3\u003e\u003cstrong\u003eThe Omega Accords Book #4\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eThey walked away from me five years ago with one request- stay away\u003c\/p\u003e\n\u003cp\u003eI’ve had five years to change my life, five years to discover who I am, and who I want to be. To grow strong in the agony of their rejection. Still, when I see them, I come alive and no matter how much we promise to stay away, fate’s not done with us yet. When I’m delivered into their arms after I become the target of a crazed serial killer, I am forced to face the truth.\u003c\/p\u003e\n\u003cp\u003eThey don’t want me here.\u003cbr\u003eBut now, my pack is all that stands between me and the killer who wants me dead.\u003c\/p\u003e\n\u003cp\u003eFive years ago we made a decision and walked away from Hazel Waters. She is the one person none of us wanted to hurt. But now she’s here and we could lose her forever. We can’t let that happen.\u003cbr\u003eWe won’t lose her again. As the past and present collide, threatening everything we’ve built and everything we could have; we find there are only two truths that really matter...\u003c\/p\u003e\n\u003cp\u003eWe need her more than air and…\u003cbr\u003eWe don’t have an omega. We’ve always had two.\u003c\/p\u003e\n\u003cp\u003eThis book is a why choose novel, meaning our female main character will end up with three or more partners. There is also MM content. Please read the trigger warnings inside the book\u003c\/p\u003e","brand":"Tea Ravine","offers":[{"title":"Signed","offer_id":42530143305818,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/thepacksrequesttearavine.jpg?v=1762482847"},{"product_id":"scent-of-home-tea-ravine","title":"Scent of Home - Tea Ravine","description":"\u003cp\u003e\u003cem\u003e\u003cstrong\u003eInterconnected Standalone Book 1\u003c\/strong\u003e\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003eWhen it Raines it pours and I’m on the bus to nowhere with a dream that shouldn’t exist\u003c\/p\u003e\n\u003cp\u003eOn the bus to nowhere I meet Locke Raines who is as mysterious as he is appealing. He looks familiar yet hoards secrets and pain and the only promise he’ll commit to, is that this is a one time thing. We’re both running from something and the perfect place to hide is in the idyllic little town at the end of the nowhere trip.\u003c\/p\u003e\n\u003cp\u003eLocke and I are confronted by two stubborn surly alphas and a remarkable beta, if only they could see how perfect they could be together. But the longer we’re here, the more my fantasy turns into a vision of a future that I want to fight for.\u003c\/p\u003e\n\u003cp\u003eLocke’s secrets won’t be silenced for long and the more I learn, the more I’m determined never to let him go.\u003c\/p\u003e\n\u003cp\u003eHow far will I go for a dream and a chance at a happy ending?\u003c\/p\u003e\n\u003cp\u003eErin Bradley is an alpha force unlike any our small town has ever seen. She knows herself and she knows what she wants. Us. Between Erin and Locke, we can’t stay away. They are temptation and delicious promises we have longed to hear.\u003c\/p\u003e\n\u003cp\u003eNow we need to figure out a way to get along. A way to bridge the years of hate and bitter insults. If we want what she’s offering we’re going to have to learn that maybe we need each other as much as we need her. As much as Locke needs us.\u003c\/p\u003e\n\u003cp\u003eHe’s counting on us to find a way.\u003c\/p\u003e\n\u003cp\u003eWe only have a short window before it’s too late and we lose what we never knew we had.\u003c\/p\u003e\n\u003cp\u003eThis is why choose, meaning our FMC doesn’t have to choose her happy ending, it also has MM content and contains some themes that may be distressing. You can find a comprehensive list inside the book. Happy reading.\u003c\/p\u003e","brand":"Tea Ravine","offers":[{"title":"Signed","offer_id":42530279882842,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/scentofhometearavine.jpg?v=1762485453"},{"product_id":"nest-of-lies-tea-ravine","title":"Nest of Lies - Tea Ravine","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"hdz3uw-qv2z5b-ixb3jt-fqq4n\" data-cel-widget=\"productTitle\"\u003eWhen It Raines Omegaverse Book #2\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan class=\"a-size-large celwidget\" data-csa-c-id=\"hdz3uw-qv2z5b-ixb3jt-fqq4n\" data-cel-widget=\"productTitle\"\u003e\u003cstrong\u003e*Interconnected Standalone*\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eWhen it Raines it pours and I’ve been staring out of windows watching them for too long\u003c\/p\u003e\n\u003cp\u003eI’ve been locked up in this house watching the Mirakill MC Pack since they moved in next door. Those motorcycle riding, leather wearing outlaw alphas who make my heart race. All their wild parties and comings and goings is pure temptation into a world of sin that I am desperate to experience.\u003c\/p\u003e\n\u003cp\u003eI’m a girl that gets left forgotten and I’m not the perfect beta they think I am. The truth is so much worse. They make me forget I can’t fly, and even if I’m a bit damaged, my heart belongs to them.\u003c\/p\u003e\n\u003cp\u003eLia Raines is off limits. The innocent, wildly inappropriate beta with a big heart and fearless eyes is absolutely not allowed near our club. We would destroy a woman as innocent as her and to see the fiery glow in Lia’s eyes go out would be the worst crime we could commit.\u003c\/p\u003e\n\u003cp\u003eShe won’t stay away and I can’t keep my pack on a leash much longer, not when all of us can’t keep our eyes and hands off the delectable little bundle of trouble.\u003c\/p\u003e\n\u003cp\u003eBut Lia’s secrets aren’t the only ones we’re keeping and when she finds out we might lose her forever anyway.\u003c\/p\u003e\n\u003cp\u003eThis is why choose, meaning our FMC doesn’t have to choose her happy ending, it also has MM content and contains some themes that may be distressing. You can find a comprehensive list inside the book. Happy reading.\u003c\/p\u003e","brand":"Tea Ravine","offers":[{"title":"Signed","offer_id":42530279948378,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/nestofliestearavine.jpg?v=1762485528"},{"product_id":"our-deceptive-heat-tea-ravine","title":"Our Deceptive Heat - Tea Ravine","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"si1cvl-uhaf5d-61v8kd-8niur4\" data-cel-widget=\"productTitle\"\u003eWhen it Raines Omegaverse Book #3\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong\u003e\u003cspan class=\"a-size-large celwidget\" data-csa-c-id=\"si1cvl-uhaf5d-61v8kd-8niur4\" data-cel-widget=\"productTitle\"\u003e*Interconnected Standalone*\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eWhen it Raines it pours and I’m running while I still can\u003c\/p\u003e\n\u003cp\u003eFate’s Choice are not just an escape, but a chance of living out my dream seeing my music sung by them to thousands of adoring fans. But as fast as I fell for them, they made it perfectly clear that I am basically the poster child for friend zoned. A year ago, I ran, I couldn’t take it anymore. I cut contact. But now they’re back, demanding the song I promised them. Furious at my betrayal.\u003c\/p\u003e\n\u003cp\u003eThey don’t know how many secrets I keep and the clock is ticking. My father, Typhor Raines, is going to trade me the minute he finds a lucrative merger and all my dreams will be ash. No more music. No more Fate’s Choice. I’d rather risk it all than submit myself to that life.\u003c\/p\u003e\n\u003cp\u003eI need their help.\u003cbr\u003eBut how can I trust them when they can’t trust me?\u003c\/p\u003e\n\u003cp\u003eRyn Raines is beautiful, a lyrical genius with the voice of an angel. She belongs on the stage. She belongs with us, except that can never happen. Setting her into the friend zone is easy, keeping her there is not. And when her secrets start tumbling out into the open, we’re left with a choice.\u003c\/p\u003e\n\u003cp\u003eWe can save ourselves or save her.\u003cbr\u003eShe might have a secret she’s dying to keep hidden and a family she’s desperate to escape.\u003c\/p\u003e\n\u003cp\u003eBut there’s a reason it will never work between us.\u003cbr\u003eOur secret would burn our worlds to the ground, destroying all five of us.\u003cbr\u003eAnd we can’t bear to see her fall.\u003c\/p\u003e\n\u003cp\u003eThis is why choose, meaning our FMC doesn’t have to choose her happy ending, it also has MM content and contains some themes that may be distressing. You can find a comprehensive list inside the book. Happy reading.\u003c\/p\u003e","brand":"Tea Ravine","offers":[{"title":"Signed with Art","offer_id":42530282307674,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/ourdeceptiveheattearavine.jpg?v=1762485629"},{"product_id":"a-vow-of-blood-c-m-quinn","title":"A Vow of Blood - C M Quinn","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"x17ws9-igcott-ph8r84-xvxlbd\" data-cel-widget=\"productTitle\"\u003ePart of The Purgatory Chronicles\u003c\/span\u003e\u003c\/h3\u003e\n\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan class=\"a-size-large celwidget\" data-csa-c-id=\"x17ws9-igcott-ph8r84-xvxlbd\" data-cel-widget=\"productTitle\"\u003e*\u003cspan\u003eSet 10 years before ‘A Song of Death’*\u003c\/span\u003e\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003eMonster. Vicious. Alone.\u003c\/p\u003e\n\u003cp\u003eAll Aya Sinclair has ever known since the extermination of her people is that no one can know her secret, or she too, will follow them to the grave. At sixteen, she’s made a name for herself in the Dusk Quarter but at a price.\u003c\/p\u003e\n\u003cp\u003eHer latest mission ought to be a simple one, but a chance discovery will alter the course of her life—\u003cbr\u003eforever. Now, she must do what she has never done before—trust a stranger, forge a bond, and her carve out the home she never thought possible.\u003c\/p\u003e\n\u003cp\u003eFor the last necromancer, it’s time for a little carnage.\u003c\/p\u003e","brand":"C M Quinn","offers":[{"title":"Default Title","offer_id":42572086149210,"sku":null,"price":28.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/avowofbloodcmquinn.jpg?v=1763431863"},{"product_id":"supernova","title":"Supernova - J A Jude","description":"\u003ch3\u003e\u003cstrong\u003eThe Gray Knights Book #1\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan\u003eOne night.\u003cbr\u003eThat’s all it takes to alter someone’s life. All it takes to change your whole perspective. All it takes to divert your whole trajectory. That’s all it took for me.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eI always had this gut feeling that things would not remain as they were. That my perfect little life—my perfect boyfriend and perfect town—would come to an end.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan class=\"a-text-italic\"\u003eAnd boy was I right.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eA girl couldn’t be this happy. Something had to burst that bubble. And burst it did.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eBurst. Explode. Detonate. Combust.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWolf shifters, supernatural hunters and secret training academies. How was this my life?\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eI was played. I was lied to. And now it was time for me to finally take control.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eBut which side was I meant to be on? The pack or the Knights?\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis wasn’t the fairytale I imagined it would be.\u003cbr\u003e\u003cbr\u003e\u003c\/span\u003e\u003cspan class=\"a-text-bold\"\u003eSupernova is Book 1 in The Gray Knights series.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003e*Perfect for readers who love paranormal romance or urban fantasy books with a wolf shifter\/werewolf take and a training academy feel. For lovers of authors like Jaymin Eve, K.F. Breene, Leia Stone, Everly Frost, Tate James, Moonlight Muse, Lauren Roberts and Rebecca Yarros. The classic will-they-won't-they trope as well as hint of betrayal, many steamy training scenes, slow-burn romance, inner-monologue sarcasm, two beautiful male interests, magical school (kind-of) and a lot of sexual tension (but fade to black). Recommended for 16+ due to language and sexual situations.\u003c\/span\u003e\u003c\/p\u003e","brand":"J.A. Jude","offers":[{"title":"Signed and Bonus Artwork","offer_id":43374522007642,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_41.png?v=1779343701"},{"product_id":"festive-fates","title":"Festive Fates - K L Steele","description":"\u003cp\u003e\u003cspan\u003eBeing home for the holidays should be comforting, a time of joy and happiness surrounded by those you care about most.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eYet, here I am, heart pounding through my chest, tempted to jump back on the plane and fly back. Even though Christmas is only a few days away, home isn’t a place I really want to be.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eAfter years of tear-filled phone calls from Mom, I finally caved, stepping foot back in the town I had avoided for years. All because of a certain alpha, one who made it his mission to chase me out.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eI expected high emotions being back there, my wolf having revealed the moment I left this place after lying dormant when I needed her most.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWhat I didn’t expect was \u003c\/span\u003e\u003cspan class=\"a-text-italic\"\u003ethem\u003c\/span\u003e\u003cspan\u003e, or the fact that being around them would trigger a chain of events that I could never come back from.\u003cbr\u003e\u003cbr\u003eWhat started as a small trip to see my family for Christmas became something so much more, altering my life in ways I never thought were possible.\u003c\/span\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"K.L. Steele","offers":[{"title":"Signed","offer_id":43388521775194,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book.png?v=1779692904"},{"product_id":"house-of-crimson-hearts","title":"House of Crimson Hearts - Ruby Roe","description":"\u003ch3\u003e\u003cspan class=\"a-text-bold\"\u003eKingdom of Immortal Lovers Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold\"\u003eOnce upon a time, a vampire corrupted a hunter.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eOctavia Beaumont, one of the original three vampires, is determined to run the city.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eRed, an expert hunter, is hell-bent on getting revenge on the vampire that turned her sister.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWhen deadly trials for the heir of the city begin, Red and Octavia are forced to work together.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eOctavia wants a crown.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eRed wants blood.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eBut there’s only one first place.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eTo win, they’re going to have to trust each other. But teamwork is not easy when their past is filled with betrayal…\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eA betrayal Red can’t remember.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eSomeone is lying.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eSomeone has a secret.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eEveryone has a hidden agenda.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThe last thing Red and Octavia want to do is fall in love… But hearts remember, even when the mind doesn’t.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eTo win the trials and get revenge…\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThey must reveal a truth that will shatter their souls.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eRemember a past that will break their hearts.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eAnd fight a war that will change the face of the city forever.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold\"\u003eThree tasks. Three choices. Three sacrifices.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold\"\u003eAll of them have a cruel price. The question is, are they willing to pay it?\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold a-text-italic\"\u003eThis is a very steamy lesbian vampire romance with a sprinkling of enemies to lovers and second chance romance, royals, multiple POV and timelines, bratty bedroom vampires, exhibitionism, and more. Please check author website or look inside for the trigger warnings. 18+ only.\u003c\/span\u003e\u003c\/p\u003e","brand":"Ruby Roe","offers":[{"title":"Not Signed","offer_id":43388523642970,"sku":null,"price":31.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_67.png?v=1779343702"},{"product_id":"of-sand-and-silk","title":"Of Sand \u0026 Silk - Claire Butler","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan data-cel-widget=\"productTitle\" data-csa-c-id=\"e5oo5k-ouhtdi-47kv1m-v4z1gy\" class=\"a-size-large celwidget\" id=\"productTitle\"\u003eThe Divine Tapestry Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold a-text-italic\"\u003eA deadly trial to keep his throne. A dangerous game to win his heart.\u003c\/span\u003e\u003cspan\u003e\u003cbr\u003e\u003cbr\u003eKing Heroux was a famed warlord who sought to extend his Merovian lands by invading and conquering foreign kingdoms to create a vast and wealthy empire.\u003cbr\u003e\u003cbr\u003eUntil Henri killed him.\u003cbr\u003e\u003cbr\u003eNow Henri has claimed his entire empire. The desert land of Merovia is different from anything he has ever known. The heat is punishing and the customs are strange. But more formidable than that are the people who do not want to embrace him as their new king, and the other Merovian kings who are keen to exact revenge on him for slaying one of their own.\u003cbr\u003e\u003cbr\u003eAs former regent and brother to the late King Heroux, Malik understands his people’s hatred toward the foreign king. But with a long-forgotten threat rising in the north, and the pending summit which will pitch all Merovian kings in a fight to the death to retain their kingdoms, Malik has little time to concern himself with Henri. Even if he does find him aggravatingly handsome.\u003cbr\u003e\u003cbr\u003eWhen a highly coveted courtesan known as the Silk Rose is gifted to Henri in the hopes of securing an alliance, motives are questioned and loyalties are tested. But the Silk Rose has her own secrets, and she refuses to be sacrificed in this world of gods and kings.\u003cbr\u003e\u003cbr\u003eSet in a rich Middle Eastern inspired world, Of Sand \u0026amp; Silk is an adult fantasy romance filled with intrigue, elemental magic, deities, plot twists, bisexual awakening, multiple POV, and MMF romance.\u003cbr\u003e\u003cbr\u003eThis is Book 1 in the Divine Tapestry series. It is linked to the Red Wood series.\u003cbr\u003e\u003cbr\u003e\u003c\/span\u003e\u003cspan class=\"a-text-italic\"\u003eOf Sand \u0026amp; Silk is perfect for fans of Renee Ahdieh, Anastasis Blythe, and Nisha J Tuli.\u003c\/span\u003e\u003c\/p\u003e","brand":"Claire Butler","offers":[{"title":"Signed Book 1","offer_id":43388556705882,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":false},{"title":"Signed Book 1 \u0026 2","offer_id":43413087158362,"sku":null,"price":55.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_47.png?v=1779343706"},{"product_id":"to-reclaim-a-kingdom","title":"To Reclaim A Kingdom - Claire Butler","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"nje03h-lvl36t-qnay5w-n5znzq\" data-cel-widget=\"productTitle\"\u003eThe Red Wood Series Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold\"\u003eTwo fallen kingdoms. Two fates intertwined. Who will rule?\u003c\/span\u003e\u003cspan\u003e\u003cbr\u003e\u003cbr\u003eA princess by birth and soon to be Queen by marriage, Brielle is eager to fulfill her great destiny; to rule the Southern Kingdom the way she rules her infamous ladies' court.\u003cbr\u003e\u003cbr\u003eA prince by birth and soon to be King, Henri also has a great destiny; to rule the Northern Kingdom, a fate he resents and resists at every opportunity.\u003cbr\u003e\u003cbr\u003eWhen both kingdoms are invaded and conquered by a foreign ruler, Brielle and Henri’s fates change. Forced to flee for their lives, their only sanctuary is the cursed Red Wood, rumored to be filled with vengeful spirits, lost souls and blood magic.\u003cbr\u003e\u003cbr\u003eSurrounded by enemies and betrayed by those closest to them, both will have choices to make. Who can they trust? What will they fight for? And what are they prepared to sacrifice to reclaim a kingdom?\u003cbr\u003e\u003cbr\u003eA fast-paced adventure full of intoxicating romance and high-stakes choices, To Reclaim A Kingdom will leave readers anxiously awaiting its sequel.\u003cbr\u003e\u003cbr\u003eIf you like Mary E. Pearson, Danielle L. Jensen, and Adrienne Young you will love this debut series!\u003cbr\u003e\u003cbr\u003eThis is Book 1 of the Red Wood Series.\u003c\/span\u003e\u003c\/p\u003e","brand":"Claire Butler","offers":[{"title":"Signed","offer_id":43388599795802,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_43.png?v=1779343705"},{"product_id":"to-reforge-a-destiny","title":"To Reforge a Destiny - Claire Butler","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"3kg1xf-dslpcj-o37per-808pm7\" data-cel-widget=\"productTitle\"\u003eThe Red Wood Series Book #2\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold\"\u003eA betrayal to repay. A kingdom to reclaim. A destiny to reforge.\u003c\/span\u003e\u003cspan\u003e\u003cbr\u003e\u003cbr\u003eBetrayed and defeated, Brielle and Henri now find themselves prisoners of the Outlaw King. Their only choice: rescind their birthrights and swear a blood oath of allegiance to their new King or face the butcher’s block. But Brielle has no intention of giving up the fight for her kingdom and Henri has vowed to never again be powerless to save the ones he loves.\u003cbr\u003e\u003cbr\u003eWith war looming, and the Southern Court in revolt against their new King, Henri and Brielle are surrounded by enemies on all sides. Forced to make alliances with those they know they cannot trust, both will be thrown into a dangerous game of court politics where losing will cost them more than their lives.\u003cbr\u003e\u003cbr\u003eAlliances will shift. Sacrifices will be made. And a dormant line of ancient blood magic will awaken. Will history be doomed to repeat itself? Or will a new destiny be reforged in the flames?\u003cbr\u003e\u003cbr\u003eFull of court intrigue, plot twists, fast-paced adventure, and intoxicating romance, To Reforge A Destiny is a thrilling conclusion to the Red Wood series.\u003cbr\u003e\u003cbr\u003eIf you like Danielle L. Jensen, Renne Ahdieh, and Adrienne Young you will love this debut series!\u003c\/span\u003e\u003c\/p\u003e","brand":"Claire Butler","offers":[{"title":"Signed","offer_id":43388600287322,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_48.png?v=1779343707"}],"url":"https:\/\/theindierealm.com.au\/collections\/fantasy-paranormal-v2.oembed?page=3","provider":"The Indie Realm","version":"1.0","type":"link"}