{"title":"Vampire Fantasy","description":"","products":[{"product_id":"power-wealth-courage-susan-hoddy","title":"Power Wealth \u0026 Courage - Susan Hoddy","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"qbd5pv-aq5q1o-ou9vh3-gpe3wr\" data-cel-widget=\"productTitle\"\u003eEmpire Of The Legacies Academy Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eIn a world of ancient legacies, forbidden love, and treacherous betrayal, one academy stands between order and chaos.\u003c\/p\u003e\n\u003cp\u003eHawk, the rebellious heir to the Griffins of Olden Fjord, and Sully, a fiercely independent Lepidoptera Vampire warrior, are forced to confront their fates when they meet at the Empire of the Legacies Academy. Though their paths collide with sparks of animosity, a deeper connection begins to form—one that might be the only hope against an imminent darkness.\u003c\/p\u003e\n\u003cp\u003eEryndor, Hawk’s adopted brother, harbors a secret that could shatter their world. Driven by jealousy and an insatiable thirst for power, he steals the legendary Twin Icefire Blades—ancient artifacts of fire and ice said to hold the power to reshape reality. With these sacred weapons, Eryndor sets his sights on revenge, vowing to bring down Norway, and plunge the world into chaos.\u003c\/p\u003e\n\u003cp\u003eAs Hawk and Sully navigate the academy’s trials, their bond is tested by betrayal, destiny, and the weight of an ancient prophecy. Can they help to stop Eryndor before the blades unleash their destructive potential? Or will their love—and the world—burn in the fires of ambition?\u003c\/p\u003e\n\u003cp\u003eEpic battles, forbidden romance, and a fight for the fate of humanity await in this thrilling tale of love, loyalty, and legacy.\u003c\/p\u003e","brand":"Susan Hoddy","offers":[{"title":"Signed","offer_id":42518459449434,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_46.png?v=1779343707"},{"product_id":"electrifying-awakening-sara-petrie","title":"Electrifying Awakening - Sara Petrie","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cstrong\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"r27e7i-7g9vtu-rsdwwd-cyn09e\" data-cel-widget=\"productTitle\"\u003eFirst Living High Nymph Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eWhen the darkness comes, it will be all-consuming, swallowing you whole until nothing is left; the light in your heart erased. When the time is near, the hidden blood will end the Titans.(The Prophecy of the Fates)\u003c\/p\u003e\n\u003cp\u003eDo you ever wonder what it would be like if magic suddenly turned your whole life upside down? Meet Juno – a sassy detective and slightly crazy mom. Her very soul burned alive, awakening her inner High Nymph.\u003c\/p\u003e\n\u003cp\u003eIn this intriguing contemporary fantasy with a why-choose twist, Juno needs to bind her Titans - all freakin’ five of them; and finds some more willing than others. Irresistible men start popping up; Fae folk claim they are her fated mate Titans.\u003c\/p\u003e\n\u003cp\u003eOne tiny issue with that - she’s already married!\u003c\/p\u003e\n\u003cp\u003eHer destiny – to claim her rightful place amongst the Fae, and restore the balance. Changes in life come thick and fast. Electrifying magic she can’t quite get a grip on, and an imminent threat of self-implosion, are not even the biggest fish to fry!\u003c\/p\u003e\n\u003cp\u003eWith the clock ticking, Juno tries to get a grip on this magical whirlwind. She seeks refuge with her husband Jay, and the ‘Queer Cheer’, her ensemble of quirky friends. She resolves to fake it ‘til she makes it… because if she fails?\u003c\/p\u003e\n\u003cp\u003e—A reign of darkness hovers over them all.\u003c\/p\u003e","brand":"Sara Petrie","offers":[{"title":"Book 1 With Artwork","offer_id":42519834755162,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":false},{"title":"Book 1 \u0026 2 With Artwork","offer_id":43413357428826,"sku":null,"price":35.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/electrifyingawakeningsarapetrie.jpg?v=1762311910"},{"product_id":"whispers-in-the-blood-s-k-may","title":"Whispers in the Blood - S K May","description":"\u003ch3\u003e\u003cstrong\u003eThe Whispers Series Book #1\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eEntire countries were destroyed when the nuclear war started. The vampires never wanted to reveal their existence, but they took control of the world to ensure that it survived.\u003c\/p\u003e\n\u003cp\u003eLarissa lives a sheltered life in a small town, where she's grown to accept the life laid out for her. After the sudden tragic death of her mother, her sister, Lucianna, convinces her to move to London so they can both have a fresh start. She agrees, ignoring the warnings from those close to her.\u003c\/p\u003e","brand":"S K May","offers":[{"title":"Signed","offer_id":42521768329306,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/whispersinthebloodskmay.jpg?v=1762325877"},{"product_id":"whispers-from-the-curse-s-k-may","title":"Whispers from the Curse - S K May","description":"\u003ch3\u003e\u003cstrong\u003eThe Whispers Series Book #2\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003eIn the aftermath of a brutal attack, Larissa finds herself in the arms of an unexpected saviour. As she begins to unravel a web of dark secrets that threaten her very existence, Nik is determined to protect her, enlisting the help of his brother, Roman.\u003c\/p\u003e\n\u003cp\u003eWhile grappling with the shocking truth about her parents, Larissa becomes increasingly entangled in a perilous curse. Balancing her responsibilities at Refresh Marketing with the chaos surrounding her, she feels the crushing weight of the world.\u003c\/p\u003e\n\u003cp\u003eNik's devotion is unwavering; he vows to keep Larissa safe at all costs, even if it means proposing marriage sooner than expected. He suspects her mother's death was no accident and that a sinister force is orchestrating events from the shadows.\u003c\/p\u003e\n\u003cp\u003eWith threats emerging from unexpected places-friends turned foes, vengeful witches, and lurking werewolves-Larissa and Nik must navigate a treacherous landscape of betrayal and magic. Will they uncover the secrets hidden in the darkness, or will Larissa ultimately succumb to the curse?\u003c\/p\u003e","brand":"S K May","offers":[{"title":"Signed","offer_id":42521819086938,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/whispersfromthecurseskmay.jpg?v=1762325947"},{"product_id":"shadows-of-the-night-charlize-k-kelly","title":"Shadows of the Night - Charlize K Kelly","description":"\u003ch3 class=\"a-spacing-none a-text-normal\"\u003e\u003cspan id=\"productTitle\" class=\"a-size-large celwidget\" data-csa-c-id=\"4yhbuh-tob84b-mv4jqr-m7xumq\"\u003eShadows of the Night Duet Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e“Nothing good ever came without sacrifice. Some of us just found clarity in the darkness of those shadows.”\u003c\/p\u003e\n\u003cp\u003e***\u003cbr\u003eNyx Monroe grew up with terrifying tales of golden-eyed beasts with nightmarish fangs and murderous tendencies but as time passed, she forgot about them, convinced they were just scary stories. When her father, Azeil Monroe, is tasked with solving the murders plaguing the coastal city of Celacali, it’s a chance at a fresh start.\u003c\/p\u003e\n\u003cp\u003eHowever, Nyx discovers everything is not what it seems beneath the veneer of the popular tourist location, also known as the City of the Dead. Something dark resides there—death and carnage reincarnate.\u003c\/p\u003e\n\u003cp\u003ePlunged into the city’s shadows, Nyx stumbles into the open arms of notorious Orion, Kotori, Niko, and Kade—the boardwalk is their blood-stained domain.\u003c\/p\u003e\n\u003cp\u003eThey’ve been waiting for twenty-five years to exact their revenge for a debt long overdue, luring Nyx and her father back to where it all began. Whilst they distract Azeil with one murder case after the other, their focus shifts to Nyx.\u003c\/p\u003e\n\u003cp\u003eSoon, there’s nowhere left for her to run—to hide—from the true beasts of legend, or from the darkness of her past.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eContent and Trigger Warnings:\u003cbr\u003eAlcohol and drug usage, assault, attempted rape, bestial violence, blood, death, divorce, emotional and physical abuse, fire, gore, gun violence, hallucinations, flashbacks, hostage and kidnapping situations, murder, profanity, PTSD, religious metaphors, sexism, sexual harassment, sexually explicit scenes, torture, violence, polyamory, BDSM, stalking, voyeurism, corruption, age gaps, exhibitionism, degradation, character deaths, threesome, knives, consensual and non-consensual biting, dubious consent\u003c\/p\u003e","brand":"Charlize K Kelly","offers":[{"title":"Signed","offer_id":42524548431962,"sku":null,"price":34.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/shadowofthenightcharlizekelly.jpg?v=1762333689"},{"product_id":"house-of-crimson-hearts","title":"House of Crimson Hearts - Ruby Roe","description":"\u003ch3\u003e\u003cspan class=\"a-text-bold\"\u003eKingdom of Immortal Lovers Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold\"\u003eOnce upon a time, a vampire corrupted a hunter.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eOctavia Beaumont, one of the original three vampires, is determined to run the city.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eRed, an expert hunter, is hell-bent on getting revenge on the vampire that turned her sister.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWhen deadly trials for the heir of the city begin, Red and Octavia are forced to work together.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eOctavia wants a crown.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eRed wants blood.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eBut there’s only one first place.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eTo win, they’re going to have to trust each other. But teamwork is not easy when their past is filled with betrayal…\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eA betrayal Red can’t remember.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eSomeone is lying.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eSomeone has a secret.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eEveryone has a hidden agenda.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThe last thing Red and Octavia want to do is fall in love… But hearts remember, even when the mind doesn’t.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eTo win the trials and get revenge…\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThey must reveal a truth that will shatter their souls.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eRemember a past that will break their hearts.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eAnd fight a war that will change the face of the city forever.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold\"\u003eThree tasks. Three choices. Three sacrifices.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold\"\u003eAll of them have a cruel price. The question is, are they willing to pay it?\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan class=\"a-text-bold a-text-italic\"\u003eThis is a very steamy lesbian vampire romance with a sprinkling of enemies to lovers and second chance romance, royals, multiple POV and timelines, bratty bedroom vampires, exhibitionism, and more. Please check author website or look inside for the trigger warnings. 18+ only.\u003c\/span\u003e\u003c\/p\u003e","brand":"Ruby Roe","offers":[{"title":"Not Signed","offer_id":43388523642970,"sku":null,"price":31.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_67.png?v=1779343702"},{"product_id":"nights-of-noctis","title":"Nights of Noctis - Lauren M Clark","description":"\u003ch3\u003e\u003cstrong\u003e\u003cspan class=\"a-text-italic\"\u003eThe Resonance Saga Book #1\u003c\/span\u003e\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan class=\"a-text-italic\"\u003eNOCTIS\u003c\/span\u003e\u003cspan\u003e\u003cbr\u003e\u003c\/span\u003e\u003cspan class=\"a-text-italic\"\u003eThe Realm of Night\u003c\/span\u003e\u003cspan\u003e\u003cbr\u003e\u003c\/span\u003e\u003cspan class=\"a-text-italic\"\u003eWhat is lost in darkness may never be found\u003c\/span\u003e\u003cspan\u003e\u003cbr\u003e\u003cbr\u003eIvy Winterstone knows she’s destined for more than what Ternewell has to offer. When she encounters Leseldh, the air crackles with electricity and dark promise. He invites her to accompany him for an evening in Noctis, and fate’s call makes the choice a simple one.\u003cbr\u003e\u003cbr\u003eAlthough Ivy has made the Portal Journey to the Realm of Night before, this trip alters her life forever. Not only does she find herself Created as a Vampire, she learns that her Sire is also her Mate. Could this be everything Ivy's been searching for?\u003cbr\u003e\u003cbr\u003eBut a newly Created Vampire is vulnerable until they complete the Ascension at the end of their first year. No one knows this better than Killian Maurell: the Vampire known as the Hunter. He sets his sights on Ivy and is determined to bring about her Ending.\u003cbr\u003e\u003cbr\u003eOnce the Ascension is complete, Ivy and Leseldh can seal their Resonance bond – but can Ivy avoid the Hunter until then?\u003c\/span\u003e\u003c\/p\u003e","brand":"Lauren M Clark","offers":[{"title":"Signed","offer_id":43388760686682,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_39.png?v=1779343705"},{"product_id":"bloodsong","title":"Bloodsong - Serra Rose","description":"\u003ch3\u003e\u003cspan\u003eThe Bloodsong Series Book #1\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan\u003eQuinn thought launching this new step in her singing career would be the only thing on her mind. But fate, it seems, has other plans. Because the sexy and mysterious stranger who comes to watch her sing immediately grabs her eye—and stirs all her wildest fantasies.\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eExcept Matteo has deep secrets, and when Quinn catches him mid-feed, a whole new world of vampires is opened up to her. And she’s his new obsession.\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eIn all his centuries, Matteo has never seen a masterpiece like Quinn. The second he hears her voice, he knows she’s meant to be his. His to claim. His forever. Just his.\u003c\/span\u003e\u003cbr\u003e\u003cbr\u003e\u003cspan\u003eTorn between normalcy and this dark new reality, she’s unsure how long she can resist her desire and the danger it brings—now that his hunger has drawn deadly attention.\u003c\/span\u003e\u003c\/p\u003e","brand":"Serra Rose","offers":[{"title":"Signed","offer_id":43388796141658,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_37.png?v=1779343707"},{"product_id":"consumed","title":"Consumed - Serra Rose","description":"\u003ch3\u003e\u003cspan\u003eThe Bloodsong Series Book #2\u003c\/span\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan\u003eThe King is on the hunt...\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eCarlos has lived for nearly a thousand years. His human life ended, and he never looked back. As a vampire, he could take what he wanted, feed and kill without remorse. The Vampire War ceased centuries ago, but the animosity lives on. Now, Venice is his domain, and his clan are his responsibility. Anyone who dares to challenge him will face his wrath.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eCamila’s entire life purpose has been to eradicate vampires. It’s all she’s ever known. Her mother is killed in a hunt, and she’s sent to Venice to investigate a possible vampire related-death. What was supposed to be a solo vampire is actually one of the most bloodthirsty killers in history, and King to his loyal clan. Hunters find strength in numbers, but she must face him alone.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eCarlos and Camila’s attempts to kill each other pull them into the most brutal battle either one of them has fought yet. Will the King be brought to his knees, or will Huntress and vampire be consumed by the fire within?\u003c\/span\u003e\u003c\/p\u003e","brand":"Serra Rose","offers":[{"title":"Signed","offer_id":43388815376474,"sku":null,"price":33.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/Template_Book_35.png?v=1779343705"},{"product_id":"blind-date-with-a-book-fantasy","title":"Blind Date With a Book - Fantasy","description":"","brand":"The Indie Realm","offers":[{"title":"Fantasy","offer_id":43389587292250,"sku":null,"price":30.0,"currency_code":"AUD","in_stock":true},{"title":"Shifters","offer_id":43389543481434,"sku":null,"price":30.0,"currency_code":"AUD","in_stock":true},{"title":"Omegaverse","offer_id":43389543514202,"sku":null,"price":30.0,"currency_code":"AUD","in_stock":true},{"title":"Vampire","offer_id":43389543546970,"sku":null,"price":30.0,"currency_code":"AUD","in_stock":true},{"title":"Why Choose","offer_id":43389543579738,"sku":null,"price":30.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/TemplateBook_c038c9a2-2fde-4443-8272-a58c00dae008.png?v=1779951157"},{"product_id":"the-lepidoptera-vampire-series-susan-hoddy","title":"The Lepidoptera Vampire Series Bundle - Susan Hoddy","description":"\u003ch3\u003e\u003cem\u003e\u003cstrong\u003eBundle Series Books 1-4 Included\u003c\/strong\u003e\u003c\/em\u003e\u003c\/h3\u003e\n\u003ch3\u003e\u003cem\u003e\u003cstrong\u003eBook 1 - Attraction\u003c\/strong\u003e\u003c\/em\u003e\u003c\/h3\u003e\n\u003cp\u003e\u003cspan\u003eViolette Castell is a quiet, high achieving teenager, living with her family in Los Angeles. When her parents die in a horrific carjacking, Violette and her sister, Danielle, are fostered to a couple who move them to Bagnolet, France. When Violette meets charming Michael Gramaze, she feels an instant magnetism toward him. As their attraction for each other grows, Violette stumbles upon the truth about Michael and his family of vampires. She is thrust into a world of danger and secrecy, where rival vampire dynasties fight for power, and where the very existence of the human race hangs in the balance. Desperate to keep his family secret, Violette is drawn into an unruly duel between good and evil, and discovers she has more of a role to play in this battle than she could ever have imagined.\u003c\/span\u003e\u003c\/p\u003e","brand":"Susan Hoddy","offers":[{"title":"Signed Bundle","offer_id":43520464027738,"sku":null,"price":60.0,"currency_code":"AUD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0614\/8472\/8410\/files\/TemplateBook_7.png?v=1781847788"}],"url":"https:\/\/theindierealm.com.au\/collections\/omegaverse-v2-copy.oembed","provider":"The Indie Realm","version":"1.0","type":"link"}